Footprints Stock Footage: Royalty-Free Video Clips

Royalty-free Stock Footage Clips

Footage

555 results found for footprints

footprints forestfootprintfootprints animationfootstepswalkingcavefingerprintsstepsfootprints snowfoot print
Clear Filters

Media Type

Resolution

Frame Rate

Duration

0:001:00+

Media Details

Usage Rights

Categories

"footprints"
Footage

Tracking closeup footage of footprints on the golden wet sand at beach

Footprint On The Wall

Cinematic atmosphere in summertime beach shot, footprints left in the sand by family or friends walk in diffused sunlight

Woman in hat and swimsuit by serene ocean with sandy beach, logs, and footprints

Legs of woman tourist barefooted feet walking on sandy ocean beach leaving footprints in luxury resort at sunset outdoors. Female enjoying

Woman walking on snow and leaving tracks, steady, slow motion shot at 240fps

Footprints in the sand at beach, sunset

NEW

Aerial view of traditional salt farmer working on black sand beach, Klungkung, Bali, Indonesia.

NEW

Aerial view of the serene dunes of Corralejo at sunset, Parque Natural de Corralejo, Fuerteventura, Spain.

Woman enjoying peaceful beach moment with open arms on spring weekend. African American model embracing freedom at empty shore. Solitude and serenity concept.

Barefoot person in flowing dress walks along sandy Waves gently wash over footprints. Peaceful beach stroll at sunset provides tranquil

NEW

Young boy joyfully running along the sandy coastline

Slim legs walking beach at ocean waves closeup. Woman stroll leaving footprints on sand coastline. Unrecognized african american girl enjoy summer tropical vacation at shore. Relaxation romantic mood.

NEW

Tropical beach landscape with palm trees and clear waters in Seychelles

Ocean girl open arms feel free at empty beach. Black hair woman breathing rest windy shore on vacation. Inspired happy african american enjoying life sea breeze on travel weekend. Serene happy female.

NEW

A fluffy dog wanders through thick, fresh snow in a bustling urban setting, surrounded by tall buildings

Panning shot of footprints on sandy beach. Closeup of waves splashing at sea shore. Concept of beautiful nature.

Aerial view of person walking on snow, person crawling on scar in winter, footprints in the snow

Girl in white dress walking on the sand beach on sunny day. Slow motion.

View of the famous TLC Chinese Theatre in Hollywood with people, tourists visiting. Los Angeles, LA, California, Unites States of America, USA. Sequence

Feet of a woman walking on a beach

NEW

A person joyfully walking an adorable Akita dog through a snowy winter landscape, showcasing beautiful vibes

Hand makes art on sand with gesture, thumb and nail

NEW

Aerial view of traditional salt farmers working on black sand beach, Karangasem, Bali, Indonesia.

A Tender Moment as a Mother Guides Her Baby’s First Steps on a Sunlit Sardinian Beach in 2020, Capturing the Essence of Early Childhood and Maternal Love.

A person walking in the snow with the microstock plus logo in the background

Sand dune footprints drone view on dusk. Nature texture in sunset light. Journey across sandy landscape. Exploration discovery in wilderness

Beach woman admiring landscape play with sand. Black hair traveler watch waves enjoy windy tranquil ocean shore on spring trip. Lonely african american rest dream in sunlight. Travel leisure concept

NEW

A serene winter landscape portraying a woman standing by the snowy road amidst natures beauty. Stock Clip

Men's Footprints on Snow-Covered Track

NEW

Aerial view of tranquil beach and ocean with footprints on shore, Ratenggaro, Sumba, Indonesia.

NEW

Engaging in a leisurely stroll, Winter Walkers navigate a beautifully blanketed, snowy path. Stock Clip

girl with festive makeup walking sand at night. Seductive african american spinning on beach in light. Slim model looking camera

NEW

Embarking on an Adventure Exploring the Depths of a Mysterious and Enigmatic Cave

NEW

Aerial view of person walking through heart-shape made of stones, dunes in soft colors and warm tones, Corralejo, Canary Islands, Spain.

NEW

Imagine strolling barefoot along the beautiful on a sunny day, feeling the warm sand beneath your feet and the gentle waves lapping at the

NEW

Footprints in Soft Beach Sand

Footprints on the red sand in Wadi Rum desert, also known as The Valley of Moon, Hashemite Kingdom of Jordan

NEW

Person cleaning a tiled patio with a broom, surrounded by potted plants and children's toys, creating a sense of tidiness and outdoor maintenance

NEW

Aerial view of beautiful tropical beach with serene ocean waves and untouched shoreline, Fiji location.

Man walking on the beach, slow motion shot at 120fps

NEW

A person is taking a leisurely stroll with an Akita dog in the snow, both dressed in a cozy winter outfit

NEW

A playful dog joyfully explores a snowy landscape among evergreen trees in this magical winter wonderland

NEW

Enjoying a Serene Winter Walk Through a Beautiful and Snowy Countryside Landscape Today. Stock Clip

A person in a black jacket walks through a snowy forest in this scenic winter video. The peaceful atmosphere of the snowcovered landscape is

woman going dark coast sea at night. Attractive curly model walk waves posing in light. Slim african american step in swimsuit jacket

Female feet going relaxed in sea water edge at sunrise, reflection on the water. Woman's legs walking barefoot along seaside in the summer

Female feet walking barefoot on wet sand at ocean Sea surf at sunrise. Legs of young woman in dress going relaxed along ocean coast